PDB entry 1kid

View 1kid on RCSB PDB site
Description: groEL (hsp60 class) fragment (apical domain) comprising residues 191-376, mutant with ala 262 replaced with leu and ile 267 replaced with met
Class: chaperone
Keywords: chaperone, hsp60, groEL, cell division, ATP-binding, phosphorylation
Deposited on 1996-12-13, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (10-202)
      • engineered (12-16)
      • engineered (88)
      • engineered (93)
    Domains in SCOPe 2.07: d1kida_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kidA (A:)
    mrgshhhhhhglvprgsegmqfdrgylspyfinkpetgavelespfilladkkisnirem
    lpvleavakagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdia
    tltggtviseeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqi
    eeatsdydreklqervaklaggv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kidA (A:)
    glvprgsegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavaka
    gkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvise
    eigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydre
    klqervaklaggv