PDB entry 1kib

View 1kib on RCSB PDB site
Description: cytochrome c6 from Arthrospira maxima: an assembly of 24 subunits in the form of an oblate shell
Class: electron transport
Keywords: cytochrome oligomer
Deposited on 2001-12-03, released 2002-07-03
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.204
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c6
    Species: ARTHROSPIRA MAXIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kiba_
  • Chain 'B':
    Compound: cytochrome c6
    Species: ARTHROSPIRA MAXIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kibb_
  • Chain 'C':
    Compound: cytochrome c6
    Species: ARTHROSPIRA MAXIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kibc_
  • Chain 'D':
    Compound: cytochrome c6
    Species: ARTHROSPIRA MAXIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kibd_
  • Chain 'E':
    Compound: cytochrome c6
    Species: ARTHROSPIRA MAXIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kibe_
  • Chain 'F':
    Compound: cytochrome c6
    Species: ARTHROSPIRA MAXIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kibf_
  • Chain 'G':
    Compound: cytochrome c6
    Species: ARTHROSPIRA MAXIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kibg_
  • Chain 'H':
    Compound: cytochrome c6
    Species: ARTHROSPIRA MAXIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kibh_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kibA (A:)
    gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
    ampgfngrlspkqiedvaayvvdqaekgw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kibB (B:)
    gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
    ampgfngrlspkqiedvaayvvdqaekgw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kibC (C:)
    gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
    ampgfngrlspkqiedvaayvvdqaekgw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kibD (D:)
    gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
    ampgfngrlspkqiedvaayvvdqaekgw
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kibE (E:)
    gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
    ampgfngrlspkqiedvaayvvdqaekgw
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kibF (F:)
    gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
    ampgfngrlspkqiedvaayvvdqaekgw
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kibG (G:)
    gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
    ampgfngrlspkqiedvaayvvdqaekgw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kibH (H:)
    gdvaagasvfsancaachmggrnvivanktlsksdlakylkgfdddavaavayqvtngkn
    ampgfngrlspkqiedvaayvvdqaekgw