PDB entry 1kgp

View 1kgp on RCSB PDB site
Description: R2F from Corynebacterium Ammoniagenes in its Mn substituted form
Class: metal binding protein
Keywords: helix bundle, arm exchange, radical protein, METAL BINDING PROTEIN
Deposited on 2001-11-28, released 2001-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonucleotide reductase protein R2F
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kgpa_
  • Chain 'B':
    Compound: Ribonucleotide reductase protein R2F
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kgpb_
  • Chain 'C':
    Compound: Ribonucleotide reductase protein R2F
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kgpc_
  • Chain 'D':
    Compound: Ribonucleotide reductase protein R2F
    Species: Corynebacterium ammoniagenes [TaxId:1697]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kgpd_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kgpA (A:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgpA (A:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kgpB (B:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgpB (B:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kgpC (C:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgpC (C:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kgpD (D:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgpD (D:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls