PDB entry 1kgo

View 1kgo on RCSB PDB site
Description: R2F from Corynebacterium Ammoniagenes in its reduced, Fe containing, form
Deposited on 2001-11-28, released 2001-12-21
The last revision prior to the SCOP 1.65 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.163
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1kgoa_
  • Chain 'B':
    Domains in SCOP 1.65: d1kgob_
  • Chain 'C':
    Domains in SCOP 1.65: d1kgoc_
  • Chain 'D':
    Domains in SCOP 1.65: d1kgod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kgoA (A:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgoA (A:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kgoB (B:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgoB (B:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kgoC (C:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgoC (C:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kgoD (D:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgoD (D:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls