PDB entry 1kgn

View 1kgn on RCSB PDB site
Description:
Deposited on 2001-11-28, released 2001-12-21
The last revision prior to the SCOP 1.65 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.158
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kgna_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kgnb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kgnc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kgnd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kgnA (A:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgnA (A:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kgnB (B:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgnB (B:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kgnC (C:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgnC (C:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kgnD (D:)
    msneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtp
    qeqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifm
    tlastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpm
    ylssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydly
    eneieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailsslspna
    denhdffsgsgssyvigkaedttdddwdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgnD (D:)
    sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
    eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
    lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
    lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
    neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls