PDB entry 1kgb

View 1kgb on RCSB PDB site
Description: structure of ground-state bacteriorhodopsin
Deposited on 2001-11-26, released 2001-12-05
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-24, with a file datestamp of 2002-04-24.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.188
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kgba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kgbA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kgbA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
    ligsegagivplnietllfmvldvsakvgfglillrsraifg