PDB entry 1kfz

View 1kfz on RCSB PDB site
Description: Solution Structure of C-terminal Sem-5 SH3 Domain (Ensemble of 16 Structures)
Class: signaling protein
Keywords: All beta protein, SIGNALING PROTEIN
Deposited on 2001-11-24, released 2003-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sex muscle abnormal protein 5
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: Sem-5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29355 (2-61)
      • cloning artifact (0-1)
      • engineered (56)
    Domains in SCOPe 2.08: d1kfza1, d1kfza2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kfzA (A:)
    hmetkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvapyn
    sn