PDB entry 1kel

View 1kel on RCSB PDB site
Description: catalytic antibody 28b4 fab fragment complexed with hapten (1-[n-4'-nitrobenzyl-n-4'-carboxybutylamino] methylphosphonic acid)
Deposited on 1996-04-16, released 1996-12-07
The last revision prior to the SCOP 1.63 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kelH (H:)
    evklvesggglgqpggslrlscatsgftftdyyfnwarqppgkalewlgfirnkakgytt
    eysasvkgrftisrdnsqgilylqmntlraedsatyycarwgsyamdywgqgtsvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kelL (L:)
    dvlmtqtplslpvslgdqasiscrfsqsivhsngntylewylqksgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn