PDB entry 1kej

View 1kej on RCSB PDB site
Description: Crystal Structure of Murine Terminal Deoxynucleotidyl Transferase complexed with ddATP
Class: transferase
Keywords: polymerase, nucleotidyl transferase, pol X family
Deposited on 2001-11-16, released 2002-05-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.263
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Terminal deoxynucleotidyltransferase short isoform
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1keja1, d1keja3, d1keja4
  • Heterogens: CO, NA, DAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kejA (A:)
    kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
    mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
    rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
    vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfek
    fkqpsrkvdaldhfqkcflilkldhgrvhseksgqqegkgwkairvdlvmcpydrrafal
    lgwtgsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwe
    rna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kejA (A:)
    kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
    mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
    rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
    vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfeq
    psrkvdaldhfqkcflilkldhgrvhseksegkgwkairvdlvmcpydrrafallgwtgs
    rqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwerna