PDB entry 1keg

View 1keg on RCSB PDB site
Description: Antibody 64M-2 Fab complexed with dTT(6-4)TT
Class: immune system/DNA
Keywords: protein-DNA complex, DNA photoproduct, immunoglobulin, IMMUNE SYSTEM-DNA COMPLEX
Deposited on 2001-11-15, released 2002-11-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*tp*(64t)p*tp*t)-3'
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: anti-(6-4) photoproduct antibody 64m-2 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KEG (0-219)
    Domains in SCOPe 2.06: d1kegh1, d1kegh2
  • Chain 'L':
    Compound: anti-(6-4) photoproduct antibody 64m-2 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KEG (0-215)
    Domains in SCOPe 2.06: d1kegl1, d1kegl2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kegH (H:)
    evqlqqsgtvlarpgasvkmsckasgysftsfwmhwvkqrpgqglewigtiypgnsdtsy
    nqkfkgkakltavtsastaymevssltnedsavyyctrrsgykyyaldywgqgtsvtvss
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kegH (H:)
    evqlqqsgtvlarpgasvkmsckasgysftsfwmhwvkqrpgqglewigtiypgnsdtsy
    nqkfkgkakltavtsastaymevssltnedsavyyctrrsgykyyaldywgqgtsvtvss
    akttapsvyplapvcgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kegL (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgslvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrn