PDB entry 1keg

View 1keg on RCSB PDB site
Description: Antibody 64M-2 Fab complexed with dTT(6-4)TT
Deposited on 2001-11-15, released 2002-11-15
The last revision prior to the SCOP 1.65 freeze date was dated 2002-11-15, with a file datestamp of 2002-11-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kegH (H:)
    evqlqqsgtvlarpgasvkmsckasgysftsfwmhwvkqrpgqglewigtiypgnsdtsy
    nqkfkgkakltavtsastaymevssltnedsavyyctrrsgykyyaldywgqgtsvtvss
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kegH (H:)
    evqlqqsgtvlarpgasvkmsckasgysftsfwmhwvkqrpgqglewigtiypgnsdtsy
    nqkfkgkakltavtsastaymevssltnedsavyyctrrsgykyyaldywgqgtsvtvss
    akttapsvyplapvcgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytl
    sssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kegL (L:)
    dvlmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgslvptfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrn