PDB entry 1keb

View 1keb on RCSB PDB site
Description: Crystal Structure of Double Mutant M37L,P40S E.coli Thioredoxin
Class: electron transport
Keywords: Thioredoxin fold, Proline, alpha-helix
Deposited on 2001-11-15, released 2002-11-13
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin 1
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • engineered (36)
      • engineered (39)
    Domains in SCOP 1.73: d1keba_
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA25 (0-107)
      • engineered (36)
      • engineered (39)
    Domains in SCOP 1.73: d1kebb_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kebA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckliasildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kebB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckliasildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla