PDB entry 1keb
View 1keb on RCSB PDB site
Description: Crystal Structure of Double Mutant M37L,P40S E.coli Thioredoxin
Class: electron transport
Keywords: Thioredoxin fold, Proline, alpha-helix
Deposited on
2001-11-15, released
2002-11-13
The last revision prior to the SCOP 1.73 freeze date was dated
2002-11-13, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Thioredoxin 1
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Uniprot P0AA25 (0-107)
- engineered (36)
- engineered (39)
Domains in SCOP 1.73: d1keba_ - Chain 'B':
Compound: Thioredoxin 1
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
- Uniprot P0AA25 (0-107)
- engineered (36)
- engineered (39)
Domains in SCOP 1.73: d1kebb_ - Heterogens: CU, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1kebA (A:)
sdkiihltddsfdtdvlkadgailvdfwaewcgpckliasildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1kebB (B:)
sdkiihltddsfdtdvlkadgailvdfwaewcgpckliasildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla