PDB entry 1keb

View 1keb on RCSB PDB site
Description: Crystal Structure of Double Mutant M37L,P40S E.coli Thioredoxin
Deposited on 2001-11-15, released 2002-11-13
The last revision prior to the SCOP 1.67 freeze date was dated 2002-11-13, with a file datestamp of 2002-11-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1keba_
  • Chain 'B':
    Domains in SCOP 1.67: d1kebb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kebA (A:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckliasildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kebB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckliasildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla