PDB entry 1kdh

View 1kdh on RCSB PDB site
Description: Binary Complex of Murine Terminal Deoxynucleotidyl Transferase with a Primer Single Stranded DNA
Class: transferase/DNA
Keywords: polymerase, nucleotidyl transferase, TRANSFERASE/DNA COMPLEX
Deposited on 2001-11-13, released 2002-05-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.239
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Terminal deoxynucleotidyltransferase short isoform
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAK07885 (0-362)
    Domains in SCOPe 2.04: d1kdha1, d1kdha3, d1kdha4
  • Chain 'D':
    Compound: 5'-d(p*(bru)p*(bru)p*(bru)p*(bru))-3'
  • Heterogens: MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kdhA (A:)
    kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
    mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
    rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
    vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfek
    fkqpsrkvdaldhfqkcflilkldhgrvhseksgqqegkgwkairvdlvmcpydrrafal
    lgwtgsrqferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwe
    rna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kdhA (A:)
    kkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpits
    mkdtegipclgdkvksiiegiiedgesseakavlnderyksfklftsvfgvglktaekwf
    rmgfrtlskiqsdkslrftqmqkagflyyedlvscvnrpeaeavsmlvkeavvtflpdal
    vtmtggfrrgkmtghdvdflitspeatedeeqqllhkvtdfwkqqglllycdilestfek
    fkqpsrldhfqkcflilkldhgrvhseksegkgwkairvdlvmcpydrrafallgwtgsr
    qferdlrryatherkmmldnhalydrtkrvfleaeseeeifahlgldyiepwerna
    

  • Chain 'D':
    No sequence available.