PDB entry 1kcv

View 1kcv on RCSB PDB site
Description: Crystal structure of antibody pc282
Deposited on 2001-11-11, released 2002-05-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-05-11, with a file datestamp of 2002-05-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcvH (H:)
    qvtlsqsgpglvkpsqslsltctvtsysitsdyawnwirqfagqslewmgyisysgstsy
    npslksrisitrdtsknqfflqlnsvttddtatyycarggtgfpywgtgtnvtvsaastt
    apsvfplvpgsataaasavtlgclvkgyfpepvtvawnegalssgvltvsavlqsglytl
    ssnttvasgtwpsasvtclvahpksstaadkkiepkd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcvL (L:)
    divmtqspksmgmsvgeavtlnckasenvgtyvswyqqkpgqspvlliygasnrytgvpd
    rftgsgsatdftltissvqadddadyycgqsysspltfgggtklelkradaaptssifpp
    sseqlssggasvvcflnsfypksiavkwkvdgskrangtanswtdqdsasstysmsstlt
    ltkdkyerhnsytceathktssspvvksfnrnec