PDB entry 1kcr

View 1kcr on RCSB PDB site
Description: crystal structure of antibody pc283 in complex with ps1 peptide
Class: immune system
Keywords: antibody, peptide antigen complex (antibody/peptide), immune system
Deposited on 2001-11-11, released 2002-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.184
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: pc283 immunoglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kcrh1, d1kcrh2
  • Chain 'L':
    Compound: pc283 immunoglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kcrl1, d1kcrl2
  • Chain 'P':
    Compound: PS1 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAK97192 (0-14)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcrH (H:)
    qvalqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyirnggstty
    npslasrisitrdtsknqfflqlnsvttedtatyycarggtgftywgagtlvtvsaaatt
    ppsvyplapgsaaaaaamvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsalytl
    sssvtvpssprpsatvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcrL (L:)
    divltqspksmsmsvgervtlsckasenvgtyvswyqqkpeqspklliygasnrytgvpd
    rftgsgsatdftlkissvqaedladyhcgqtysyptfgggtklaikradaaptvsifpps
    seqltaggasvvcflnnfypkdinvkwkidgserqngvanswtaqdsadstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.