PDB entry 1kcg

View 1kcg on RCSB PDB site
Description: NKG2D in complex with ULBP3
Deposited on 2001-11-08, released 2002-01-09
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-09, with a file datestamp of 2002-01-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1kcga_
  • Chain 'B':
    Domains in SCOP 1.59: d1kcgb_
  • Chain 'C':
    Domains in SCOP 1.59: d1kcgc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcgA (A:)
    sycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksyh
    wmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicmq
    rt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kcgB (B:)
    esycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllklvksy
    hwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpntyicm
    qrt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kcgC (C:)
    dahslwynftiihlprhgqqwcevqsqvdqknflsydcgsdkvlsmghleeqlyatdawg
    kqlemlrevgqrlrleladteledftpsgpltlqvrmsceceadgyirgswqfsfdgrkf
    llfdsnnrkwtvvhagarrmkekwekdsglttffkmvsmrdckswlrdflmhrkkrle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kcgC (C:)
    dahslwynftiihlprhgqqwcevqsqvdqknflsydcgsdkvlsmghleeqlyatdawg
    kqlemlrevgqrlrleladtepltlqvrmsceceadgyirgswqfsfdgrkfllfdsnnr
    kwtvvhagarrmkekwekdsglttffkmvsmrdckswlrdflmhrkkrle