PDB entry 1kc7

View 1kc7 on RCSB PDB site
Description: Pyruvate Phosphate Dikinase with Bound Mg-phosphonopyruvate
Deposited on 2001-11-07, released 2002-01-30
The last revision prior to the SCOP 1.71 freeze date was dated 2002-01-30, with a file datestamp of 2002-01-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kc7A (A:)
    akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiykgdietqeasvsgsferimvwadkfrtlkvrtnad
    tpedtlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgd
    fkamykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpm
    mghrgcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvv
    vevaeqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrdd
    agkfldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssv
    efchkvglnyvscspfrvpiarlaaaqaalnnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kc7A (A:)
    akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiykgdietqeasvsgsferimvwadkfrtlkvrtnad
    tpedtlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgd
    fkamykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpm
    mghrgcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvv
    vevaeqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrdd
    agkfldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssv
    efchkvglnyvscspfrvpiarlaaaqaalnn