PDB entry 1kbw

View 1kbw on RCSB PDB site
Description: crystal structure of the soluble domain of ania from neisseria gonorrhoeae
Class: oxidoreductase
Keywords: ania, oxidoreductase
Deposited on 2001-11-06, released 2001-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbwa1, d1kbwa2
  • Chain 'B':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbwb1, d1kbwb2
  • Chain 'C':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbwc1, d1kbwc2
  • Chain 'D':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbwd1, d1kbwd2
  • Chain 'E':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbwe1, d1kbwe2
  • Chain 'F':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbwf1, d1kbwf2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kbwA (A:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbwA (A:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kbwB (B:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbwB (B:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kbwC (C:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbwC (C:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kbwD (D:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbwD (D:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kbwE (E:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbwE (E:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kbwF (F:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbwF (F:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im