PDB entry 1kbv

View 1kbv on RCSB PDB site
Description: nitrite-soaked crystal structure of the soluble domain of ania from neisseria gonorrhoeae
Class: oxidoreductase
Keywords: ania[no2-], oxidoreductase
Deposited on 2001-11-06, released 2001-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.195
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbva1, d1kbva2
  • Chain 'B':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbvb1, d1kbvb2
  • Chain 'C':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbvc1, d1kbvc2
  • Chain 'D':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbvd1, d1kbvd2
  • Chain 'E':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbve1, d1kbve2
  • Chain 'F':
    Compound: Major outer membrane protein PAN 1
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: aniA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02219
      • see remark 999 (208-210)
      • see remark 999 (282)
    Domains in SCOPe 2.06: d1kbvf1, d1kbvf2
  • Heterogens: CU, NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kbvA (A:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbvA (A:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kbvB (B:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbvB (B:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kbvC (C:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbvC (C:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kbvD (D:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbvD (D:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kbvE (E:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbvE (E:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kbvF (F:)
    maaqataetpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyry
    wtfdgdvpgrmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtst
    fsfkalqpglyiyhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkk
    gaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfh
    vigeifdkvyveggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgal
    gqlkvegaenpeimtqklsdtayavpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbvF (F:)
    elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
    rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
    yhcavapvgmhiangmyglilvepkeglpkvdkefyivqgdfytkgkkgaqglqpfdmdk
    avaeqpeyvvfnghvgaltgdnalkakagetvrmyvgnggpnlvssfhvigeifdkvyve
    ggklinenvqstivpaggsaivefkvdipgnytlvdhsifrafnkgalgqlkvegaenpe
    im