PDB entry 1kbg

View 1kbg on RCSB PDB site
Description: MHC Class I H-2KB Presented Glycopeptide RGY8-6H-GAL2
Class: immune system
Keywords: MHC, major histocompatibility complex, antigen presentation, glycopeptide, cellular immunity, immunology, cell surface receptor, synthetic peptide, vaccine, immune system
Deposited on 1998-08-28, released 1999-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: protein (major histocompatibility complex class I antigen h-2kb)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01901 (0-273)
  Domains in SCOPe 2.06: d1kbgh1, d1kbgh2
• Chain 'L':
  Compound: protein (beta-2-microglobulin)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.06: d1kbgl_
• Chain 'P':
  Compound: protein (synthetic glycopeptide rgy8-6h-gal2)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11212 (0-7)
    • engineered (5)
• Heterogens: NAG, HOH

PDB Chain Sequences:

• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kbgH (H:)
  gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
  eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
  cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
  rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
  fqkwasvvvplgkeqyytchvyhqglpepltlrw
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kbgL (L:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'P':
  No sequence available.