PDB entry 1kbe

View 1kbe on RCSB PDB site
Description: Solution structure of the cysteine-rich C1 domain of Kinase Suppressor of Ras
Class: signaling protein
Keywords: Kinase Suppressor of Ras, KSR, Cysteine-rich domain, Zinc-binding protein, SIGNALING PROTEIN
Deposited on 2001-11-06, released 2002-01-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Kinase Suppressor of Ras
  Species: Mus musculus [TaxId:10090]
  Gene: KSR1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q61097 (1-48)
    • cloning artifact (0)
  Domains in SCOPe 2.06: d1kbea1, d1kbea2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kbeA (A:)
  gsvthrfstkswlsqvcnvcqksmifgvkckhcrlkchnkctkeapacr