PDB entry 1kba

View 1kba on RCSB PDB site
Description: crystal structure of kappa-bungarotoxin at 2.3-angstrom resolution
Class: toxin
Keywords: toxin
Deposited on 1994-07-13, released 1994-12-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: kappa-bungarotoxin
  Species: Bungarus multicinctus [TaxId:8616]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01398 (0-65)
  Domains in SCOPe 2.08: d1kbaa_
• Chain 'B':
  Compound: kappa-bungarotoxin
  Species: Bungarus multicinctus [TaxId:8616]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01398 (0-65)
  Domains in SCOPe 2.08: d1kbab_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kbaA (A:)
  rtclispsstpqtcpngqdicflkaqcdkfcsirgpvieqgcvatcpqfrsnyrsllcct
  tdncnh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kbaB (B:)
  rtclispsstpqtcpngqdicflkaqcdkfcsirgpvieqgcvatcpqfrsnyrsllcct
  tdncnh