PDB entry 1kb0

View 1kb0 on RCSB PDB site
Description: Crystal Structure of Quinohemoprotein Alcohol Dehydrogenase from Comamonas testosteroni
Class: oxidoreductase
Keywords: beta-propeller fold, cytochrome c, oxidoreductase
Deposited on 2001-11-05, released 2001-12-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.16
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinohemoprotein alcohol dehydrogenase
    Species: Comamonas testosteroni [TaxId:285]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46444 (0-End)
      • see remark 999 (180-181)
      • see remark 999 (565)
      • modified residue (511)
    Domains in SCOPe 2.05: d1kb0a1, d1kb0a2
  • Heterogens: CA, HEC, TFB, PQQ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kb0A (A:)
    tgpaaqaaaavqrvdgdfiranaartpdwptigvdyaetrysrldqinaanvkdlglaws
    ynlestrgveatpvvvdgimyvsaswsvvhaidtrtgnriwtydpqidrstgfkgccdvv
    nrgvalwkgkvyvgawdgrlialdaatgkevwhqntfegqkgsltitgaprvfkgkviig
    nggaeygvrgyitaydaetgerkwrwfsvpgdpskpfedesmkraartwdpsgkwweagg
    ggtmwdsmtfdaelntmyvgtgngspwshkvrspkggdnlylasivaldpdtgkykwhyq
    etpgdnwdytstqpmiladikiagkprkvilhapkngfffvldrtngkfisaknfvpvnw
    asgydkhgkpigiaaardgskpqdavpgpygahnwhpmsfnpqtglvylpaqnvpvnlmd
    dkkwefnqagpgkpqsgtgwntakffnaeppkskpfgrllawdpvaqkaawsvehvspwn
    ggtlttagnvvfqgtadgrlvayhaatgeklweaptgtgvvaapstymvdgrqyvsvavg
    wggvyglaaraterqgpgtvytfvvggkarmpefvaqrtgqllqgvkydpakveagtmly
    vancvfchgvpgvdrggnipnlgymdasyienlpnfvfkgpamvrgmpdftgklsgddve
    slkafiqgtadairpkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kb0A (A:)
    tgpaaqaaaavqrvdgdfiranaartpdwptigvdyaetrysrldqinaanvkdlglaws
    ynlestrgveatpvvvdgimyvsaswsvvhaidtrtgnriwtydpqidrstgfkgccdvv
    nrgvalwkgkvyvgawdgrlialdaatgkevwhqntfegqkgsltitgaprvfkgkviig
    nggaeygvrgyitaydaetgerkwrwfsvpgdpskpfedesmkraartwdpsgkwweagg
    ggtmwdsmtfdaelntmyvgtgngspwshkvrspkggdnlylasivaldpdtgkykwhyq
    etpgdnwdytstqpmiladikiagkprkvilhapkngfffvldrtngkfisaknfvpvnw
    asgydkhgkpigiaaardgskpqdavpgpygahnwhpmsfnpqtglvylpaqnvpvnlmd
    dkkwefnqagpgkpqsgtgwntakffnaeppkskpfgrllawdpvaqkaawsvehvspwn
    ggtlttagnvvfqgtadgrlvayhaatgeklweaptgtgvvaapstymvdgrqyvsvavg
    wggvyglaaraterqgpgtvytfvvggkarmpetgqllqgvkydpakveagtmlyvancv
    fchgvpgvdrggnipnlgymdasyienlpnfvfkgpamvrgmpdftgklsgddveslkaf
    iqgtadairp