PDB entry 1kb0

View 1kb0 on RCSB PDB site
Description: Crystal Structure of Quinohemoprotein Alcohol Dehydrogenase from Comamonas testosteroni
Deposited on 2001-11-05, released 2001-12-28
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.16
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kb0A (A:)
    tgpaaqaaaavqrvdgdfiranaartpdwptigvdyaetrysrldqinaanvkdlglaws
    ynlestrgveatpvvvdgimyvsaswsvvhaidtrtgnriwtydpqidrstgfkgccdvv
    nrgvalwkgkvyvgawdgrlialdaatgkevwhqntfegqkgsltitgaprvfkgkviig
    nggaeygvrgyitaydaetgerkwrwfsvpgdpskpfedesmkraartwdpsgkwweagg
    ggtmwdsmtfdaelntmyvgtgngspwshkvrspkggdnlylasivaldpdtgkykwhyq
    etpgdnwdytstqpmiladikiagkprkvilhapkngfffvldrtngkfisaknfvpvnw
    asgydkhgkpigiaaardgskpqdavpgpygahnwhpmsfnpqtglvylpaqnvpvnlmd
    dkkwefnqagpgkpqsgtgwntakffnaeppkskpfgrllawdpvaqkaawsvehvspwn
    ggtlttagnvvfqgtadgrlvayhaatgeklweaptgtgvvaapstymvdgrqyvsvavg
    wggvyglaaraterqgpgtvytfvvggkarmpefvaqrtgqllqgvkydpakveagtmly
    vancvfchgvpgvdrggnipnlgymdasyienlpnfvfkgpamvrgmpdftgklsgddve
    slkafiqgtadairp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kb0A (A:)
    tgpaaqaaaavqrvdgdfiranaartpdwptigvdyaetrysrldqinaanvkdlglaws
    ynlestrgveatpvvvdgimyvsaswsvvhaidtrtgnriwtydpqidrstgfkgccdvv
    nrgvalwkgkvyvgawdgrlialdaatgkevwhqntfegqkgsltitgaprvfkgkviig
    nggaeygvrgyitaydaetgerkwrwfsvpgdpskpfedesmkraartwdpsgkwweagg
    ggtmwdsmtfdaelntmyvgtgngspwshkvrspkggdnlylasivaldpdtgkykwhyq
    etpgdnwdytstqpmiladikiagkprkvilhapkngfffvldrtngkfisaknfvpvnw
    asgydkhgkpigiaaardgskpqdavpgpygahnwhpmsfnpqtglvylpaqnvpvnlmd
    dkkwefnqagpgkpqsgtgwntakffnaeppkskpfgrllawdpvaqkaawsvehvspwn
    ggtlttagnvvfqgtadgrlvayhaatgeklweaptgtgvvaapstymvdgrqyvsvavg
    wggvyglaaraterqgpgtvytfvvggkarmpetgqllqgvkydpakveagtmlyvancv
    fchgvpgvdrggnipnlgymdasyienlpnfvfkgpamvrgmpdftgklsgddveslkaf
    iqgtadairp