PDB entry 1kat

View 1kat on RCSB PDB site
Description: Solution Structure of a Phage-Derived Peptide Antagonist in Complex with Vascular Endothelial Growth Factor
Class: cell cycle, hormone/growth factor
Keywords: Protein-peptide complex, homodimer, cystine knot, CELL CYCLE, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2001-11-02, released 2002-11-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'V':
    Compound: vascular endothelial growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: VEGF or VEGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1katv_
  • Chain 'W':
    Compound: vascular endothelial growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: VEGF or VEGFA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1katw_
  • Chain 'X':
    Compound: Phage-Derived Peptide Antagonist
    Database cross-references and differences (RAF-indexed):
    • PDB 1KAT (0-18)
  • Chain 'Y':
    Compound: Phage-Derived Peptide Antagonist
    Database cross-references and differences (RAF-indexed):
    • PDB 1KAT (0-18)

PDB Chain Sequences:

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1katV (V:)
    hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
    teesnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1katW (W:)
    hhevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvp
    teesnitmqimrikphqgqhigemsflqhnkcecrpkkd
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.