PDB entry 1kap

View 1kap on RCSB PDB site
Description: three-dimensional structure of the alkaline protease of pseudomonas aeruginosa: a two-domain protein with a calcium binding parallel beta roll motif
Deposited on 1995-06-08, released 1995-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-10-15, with a file datestamp of 1995-10-16.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kapP (P:)
    grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
    fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
    dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
    tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
    aiqklyganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqn
    qkinlnekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilyg
    glgadqlwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyv
    dafagkagqailsydaaskagslaidfsgdahadfainligqatqadivv