PDB entry 1kap

View 1kap on RCSB PDB site
Description: three-dimensional structure of the alkaline protease of pseudomonas aeruginosa: a two-domain protein with a calcium binding parallel beta roll motif
Class: zinc metalloprotease
Keywords: calcium binding protein, zinc metalloprotease
Deposited on 1995-06-08, released 1995-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.176
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: tetrapeptide (gly ser asn ser)
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KAP (0-3)
  • Chain 'P':
    Compound: alkaline protease
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kapp1, d1kapp2
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'I':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1kapP (P:)
    mssnslalkgrsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapg
    dsvltlsysfltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihf
    vdagqgdqgdltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygr
    qtltheightlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgays
    sapllddiaaiqklyganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndt
    ldfsgfsqnqkinlnekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkg
    gagndilygglgadqlwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafv
    ngglvlqyvdafagkagqailsydaaskagslaidfsgdahadfainligqatqadivv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kapP (P:)
    grsdaytqvdnflhayarggdelvnghpsytvdqaaeqilreqaswqkapgdsvltlsys
    fltkpndffntpwkyvsdiyslgkfsafsaqqqaqaklslqswsdvtnihfvdagqgdqg
    dltfgnfsssvggaafaflpdvpdalkgqswylinssysanvnpangnygrqtltheigh
    tlglshpgdynagegdptyadatyaedtraysvmsyweeqntgqdfkgayssapllddia
    aiqklyganlttrtgdtvygfnsnterdfysatssssklvfsvwdaggndtldfsgfsqn
    qkinlnekalsdvgglkgnvsiaagvtvenaiggsgsdlligndvanvlkggagndilyg
    glgadqlwggagadtfvygdiaessaaapdtlrdfvsgqdkidlsgldafvngglvlqyv
    dafagkagqailsydaaskagslaidfsgdahadfainligqatqadivv