PDB entry 1kao

View 1kao on RCSB PDB site
Description: crystal structure of the small g protein rap2a with GDP
Class: GTP-binding protein
Keywords: GTP-binding protein, small g protein, rap2, GDP, ras
Deposited on 1997-08-01, released 1997-12-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rap2a
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10114 (0-166)
  Domains in SCOPe 2.06: d1kaoa_
• Heterogens: MG, GDP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kaoA (A:)
  mreykvvvlgsggvgksaltvqfvtgtfiekydptiedfyrkeievdsspsvleildtag
  teqfasmrdlyikngqgfilvyslvnqqsfqdikpmrdqiirvkryekvpvilvgnkvdl
  eserevsssegralaeewgcpfmetsaksktmvdelfaeivrqmnya