PDB entry 1ka5

View 1ka5 on RCSB PDB site
Description: Refined Solution Structure of Histidine Containing Phosphocarrier Protein from Staphyloccocus aureus
Class: ligand transport
Keywords: Open Faced beta-Sandwich, Structural Proteomics in Europe, SPINE, Structural Genomics, LIGAND TRANSPORT
Deposited on 2001-10-31, released 2003-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphocarrier protein HPr
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A0E3 (0-87)
  Domains in SCOPe 2.07: d1ka5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ka5A (A:)
  meqnsyviidetgiharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdae
  itiyadgsdesdaiqaisdvlskegltk