PDB entry 1k9a

View 1k9a on RCSB PDB site
Description: Crystal structure analysis of full-length carboxyl-terminal Src kinase at 2.5 A resolution
Class: transferase
Keywords: carboxyl-terminal Src kinase, COOH-terminal Src kinase, Csk, Src, SFK, signal transduction, SH2, SH3, Src Homology, tyrosine kinase, cytoplasmic tyrosine kinase, Cbp, oncogene, cancer, TRANSFERASE
Deposited on 2001-10-28, released 2002-03-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.246
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carboxyl-terminal Src kinase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9aa1, d1k9aa2, d1k9aa3
  • Chain 'B':
    Compound: Carboxyl-terminal Src kinase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9ab1, d1k9ab2, d1k9ab3
  • Chain 'C':
    Compound: Carboxyl-terminal Src kinase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9ac1, d1k9ac2, d1k9ac3
  • Chain 'D':
    Compound: Carboxyl-terminal Src kinase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9ad1, d1k9ad2, d1k9ad3
  • Chain 'E':
    Compound: Carboxyl-terminal Src kinase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9ae1, d1k9ae2, d1k9ae3
  • Chain 'F':
    Compound: Carboxyl-terminal Src kinase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9af1, d1k9af2, d1k9af3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k9aA (A:)
    msaiqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcv
    scegkvehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaq
    defyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvm
    tqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvce
    ameylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealre
    kkfstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmk
    ncwhldaatrptflqlreqlehirthelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9aA (A:)
    aswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyv
    qkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegk
    vehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaqdefyr
    sgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrh
    snlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyl
    egnnfvhrdlaarnvlvsednvakvsdfgltkeasklpvkwtapealrekkfstksdvws
    fgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmkncwhldaatrp
    tflqlreqlehirthelhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k9aB (B:)
    msaiqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcv
    scegkvehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaq
    defyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvm
    tqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvce
    ameylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealre
    kkfstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmk
    ncwhldaatrptflqlreqlehirthelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9aB (B:)
    iqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipan
    yvqkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcvsce
    gkvehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaqdef
    yrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtql
    rhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceame
    ylegnnfvhrdlaarnvlvsednvakvsdfgltkeagklpvkwtapealrekkfstksdv
    wsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmkncwhldaat
    rptflqlreqlehirthelhl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k9aC (C:)
    msaiqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcv
    scegkvehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaq
    defyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvm
    tqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvce
    ameylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealre
    kkfstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmk
    ncwhldaatrptflqlreqlehirthelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9aC (C:)
    aswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyv
    qkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegk
    vehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaqdefyr
    sgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrh
    snlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyl
    egnnfvhrdlaarnvlvsednvakvsdfgltkeaslpvkwtapealrekkfstksdvwsf
    gillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmkncwhldaatrpt
    flqlreqlehirthelhl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k9aD (D:)
    msaiqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcv
    scegkvehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaq
    defyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvm
    tqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvce
    ameylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealre
    kkfstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmk
    ncwhldaatrptflqlreqlehirthelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9aD (D:)
    aswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyv
    qkregvkagtklslmpwfhgkitreqaerllyppetglflvreytlcvscegkvehyrim
    yhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaqdefyrsgwalnm
    kelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhsnlvqll
    gviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameylegnnfvh
    rdlaarnvlvsednvakvsdfgltkeasstlpvkwtapealrekkfstksdvwsfgillw
    eiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmkncwhldaatrptflqlr
    eqlehirthelhl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1k9aE (E:)
    msaiqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcv
    scegkvehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaq
    defyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvm
    tqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvce
    ameylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealre
    kkfstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmk
    ncwhldaatrptflqlreqlehirthelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9aE (E:)
    aswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyv
    qkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegk
    vehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaqdefyr
    sgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrh
    snlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyl
    egnnfvhrdlaarnvlvsednvakvsdfgltkeasstlpvkwtapealrekkfstksdvw
    sfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmkncwhldaatr
    ptflqlreqlehirthelhl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1k9aF (F:)
    msaiqaswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregii
    panyvqkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcv
    scegkvehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaq
    defyrsgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvm
    tqlrhsnlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvce
    ameylegnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealre
    kkfstksdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmk
    ncwhldaatrptflqlreqlehirthelhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9aF (F:)
    aswpsgteciakynfhgtaeqdlpfckgdvltivavtkdpnwykaknkvgregiipanyv
    qkregvkagtklslmpwfhgkitreqaerllyppetglflvrestnypgdytlcvscegk
    vehyrimyhasklsideevyfenlmqlvehyttdadglctrlikpkvmegtvaaqdefyr
    sgwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrh
    snlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyl
    egnnfvhrdlaarnvlvsednvakvsdfgltkeapvkwtapealrekkfstksdvwsfgi
    llweiysfgrvpypriplkdvvprvekgykmdapdgcppavydvmkncwhldaatrptfl
    qlreqlehirthelhl