PDB entry 1k8t

View 1k8t on RCSB PDB site
Description: Crystal structure of the adenylyl cyclase domain of anthrax edema factor (EF)
Deposited on 2001-10-25, released 2002-01-23
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-23, with a file datestamp of 2002-01-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1k8ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k8tA (A:)
    dridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnv
    hgkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlri
    eelkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfn
    wrnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvt
    nllikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgteqdneefpekd
    neifiinpegefiltknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpit
    kakintiptsaefiknlssirrssnvgvykdsgdkdefakkesvkkiagylsdyynsanh
    ifsqekkrkisifrgiqayneienvlkskqiapeyknyfqylkeritnqvqlllthqksn
    iefkllykqlnftenetdnfevfqkiide
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8tA (A:)
    dridvlkgekalkasglvpehadafkkiarelntyilfrpvnklatnliksgvatkglnv
    hgkssdwgpvagyipfdqdlskkhgqqlavekgnlenkksitehegeigkiplkldhlri
    eelkengiilkgkkeidngkkyyllesnnqvyefrisdennevqyktkegkitvlgekfn
    wrnievmaknvegvlkpltadydlfalapslteikkqipqkewdkvvntpnslekqkgvt
    nllikygierkpdstkgtlsnwqkqmldrlneavkytgytggdvvnhgtneifiinpege
    filtknwemtgrfieknitgkdylyyfnrsynkiapgnkayiewtdpitkakintiptsa
    efiknlssirrssnvgvykdsgdkdefakkesvkkiagylsdyynsanhifsqekkrkis
    ifrgiqayneienvlkskqiapeyknyfqylkeritnqvqlllthqksniefkllykqln
    ftenetdnfevfqkiide