PDB entry 1k8o

View 1k8o on RCSB PDB site
Description: Solution Structure of the Lipoic Acid-Bearing Domain of the E2 component of Human, Mitochondrial Branched-Chain alpha-Ketoacid Dehydrogenase
Class: transferase
Keywords: Lipoyl Acid Bearing, Human BCKD, Experimental NMR data, TRANSFERASE
Deposited on 2001-10-24, released 2001-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-25, with a file datestamp of 2016-05-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E2 component of Branched-Chain alpha-Ketoacid Dehydrogenase
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11182 (1-84)
    • initiating met (0)
    • expression tag (85-86)
  Domains in SCOPe 2.08: d1k8oa1, d1k8oa2, d1k8oa3

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1k8oA (A:)
  mgqvvqfklsdigegirevtvkewyvkegdtvsqfdsicevqsdkasvtitsrydgvikk
  lyynlddiayvgkplvdietealkdlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1k8oA (A:)
  mgqvvqfklsdigegirevtvkewyvkegdtvsqfdsicevqsdkasvtitsrydgvikk
  lyynlddiayvgkplvdietealkdle