PDB entry 1k8k

View 1k8k on RCSB PDB site
Description: Crystal Structure of Arp2/3 Complex
Class: structural protein
Keywords: beta-propeller
Deposited on 2001-10-24, released 2001-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actin-like protein 3
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1k8ka1, d1k8ka2
  • Chain 'B':
    Compound: actin-like protein 2
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1k8kb1
  • Chain 'C':
    Compound: arp2/3 complex 41 kda subunit
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1k8kc_
  • Chain 'D':
    Compound: arp2/3 complex 34 kda subunit
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1k8kd1, d1k8kd2
  • Chain 'E':
    Compound: arp2/3 complex 21 kda subunit
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1k8ke_
  • Chain 'F':
    Compound: arp2/3 complex 20 kda subunit
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1k8kf_
  • Chain 'G':
    Compound: arp2/3 complex 16 kda subunit
    Species: BOS TAURUS
    Domains in SCOP 1.75: d1k8kg_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k8kA (A:)
    magrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldf
    figdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntp
    enreytaeimfesfnvpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipv
    aegyvigscikhipiagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvk
    efnkydtdgskwikqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevv
    deviqncpidvrrplyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelsggrlkp
    kpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeigpsicrhnpvfgvms
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8kA (A:)
    grlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekptya
    tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
    fnvpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipvaegyvigscikhi
    piagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvkefnkydtdgskwi
    kqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevvdeviqncpidvrr
    plyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelskpkpidvqvithhmqryav
    wfggsmlastpefyqvchtkkdyeeigpsicrhnpvfgvms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k8kB (B:)
    mdsqgrkvvvcdngtgfvkcgyagsnfpehifpalvgrpiirsttkvgnieikdlmvgde
    aselrsmlevnypmengivrnwddmkhlwdytfgpeklnidtrnckillteppmnptknr
    ekivevmfetyqfsgvyvaiqavltlyaqglltgvvvdsgdgvthicpvyegfslphltr
    rldiagrditrylikllllrgyafnhsadfetvrmikeklcyvgynieqeqklalettvl
    vesytlpdgriikvggerfeapealfqphlinvegvgvaellfntiqaadidtrsefykh
    ivlsggstmypglpsrlerelkqlylervlkgdveklskfkiriedpprrkhmvflggav
    ladimkdkdnfwmtrqeyqekgvrvleklgvtvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8kB (B:)
    gvvvdsgdgvthicpvyegfslphltrrldiagrditrylikllllrgyafnhsadfetv
    rmikeklcyvgynieqeqklalettvlvesytlpdgriikvggerfeapealfqphlinv
    egvgvaellfntiqaadidtrsefykhivlsggstmypglpsrlerelkqlylervlkgd
    veklskfkir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k8kC (C:)
    mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdw
    apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
    sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
    aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
    asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltare
    rfqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvr
    slesalkdlkiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8kC (C:)
    ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdwa
    pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
    icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
    ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
    setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvptarerfqnldkka
    agldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k8kD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
    inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpdaekkemktitgktfssr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8kD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
    inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpda
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1k8kE (E:)
    mpayhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyei
    kneadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakp
    ankqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsgpgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8kE (E:)
    payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
    neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
    nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1k8kF (F:)
    mtatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekek
    vliegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitn
    fhteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8kF (F:)
    tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
    liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
    hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1k8kG (G:)
    mskntvssarfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalk
    nppintksqavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdn
    ssavllqwhekalaaggvgsivrvltarktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8kG (G:)
    arfrkvdvdeydenkfvdeddgagpdegevdsclrqgnmtaalqaalknppintksqavk
    dragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwheka
    laaggvgsivrvltarktv