PDB entry 1k8i

View 1k8i on RCSB PDB site
Description: crystal structure of mouse h2-dm
Class: immune system
Keywords: MHC, immune system
Deposited on 2001-10-24, released 2001-12-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.205
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II H2-M alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-DM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k8ia1, d1k8ia2
  • Chain 'B':
    Compound: MHC class II H2-M beta 2 chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-DM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k8ib1, d1k8ib2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k8iA (A:)
    astpvfwddpqnhtfrhtlfcqdgipniglsetydedelfsfdfsqntrvprlpdfaewa
    qgqgdasaiafdksfcemlmrevspklegqipvsrglpvaevftlkplefgkpntlvcfi
    snlfpptltvnwqlhsapvegasptsisavdgltfqafsylnftpepfdlysctvtheid
    rytaiaywvpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8iA (A:)
    qnhtfrhtlfcqdgipniglsetydedelfsfdfsqntrvprlpdfaewaqgqgdasaia
    fdksfcemlmrevspklegqipvsrglpvaevftlkplefgkpntlvcfisnlfpptltv
    nwqlhsapvegasptsisavdgltfqafsylnftpepfdlysctvtheidrytaiaywvp
    q
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k8iB (B:)
    gfvahvestcvlndagtpqdftycvsfnkdllacwdpdvgkivpcefgvlsrlaeiisni
    lneqeslihrlqnglqdcathtqpfwdvlthrtrapsvrvaqttpfntrepvmlacyvwg
    fypadvtitwmkngqlvpshsnkektaqpngdwtyqtvsylaltpsygdvytcvvqhsgt
    sepirgdwtpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8iB (B:)
    gfvahvestcvlndagtpqdftycvsfnkdllacwdpdvgkivpcefgvlsrlaeiisni
    lneqeslihrlqnglqdcathtqpfwdvlthrtrapsvrvaqttpfntrepvmlacyvwg
    fypadvtitwmkngqlvpshsnkektaqpngdwtyqtvsylaltpsygdvytcvvqhsgt
    sepirgdwtp