PDB entry 1k8i

View 1k8i on RCSB PDB site
Description: crystal structure of mouse h2-dm
Deposited on 2001-10-24, released 2001-12-05
The last revision prior to the SCOP 1.65 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.205
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k8iA (A:)
    astpvfwddpqnhtfrhtlfcqdgipniglsetydedelfsfdfsqntrvprlpdfaewa
    qgqgdasaiafdksfcemlmrevspklegqipvsrglpvaevftlkplefgkpntlvcfi
    snlfpptltvnwqlhsapvegasptsisavdgltfqafsylnftpepfdlysctvtheid
    rytaiaywvpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8iA (A:)
    qnhtfrhtlfcqdgipniglsetydedelfsfdfsqntrvprlpdfaewaqgqgdasaia
    fdksfcemlmrevspklegqipvsrglpvaevftlkplefgkpntlvcfisnlfpptltv
    nwqlhsapvegasptsisavdgltfqafsylnftpepfdlysctvtheidrytaiaywvp
    q
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k8iB (B:)
    gfvahvestcvlndagtpqdftycvsfnkdllacwdpdvgkivpcefgvlsrlaeiisni
    lneqeslihrlqnglqdcathtqpfwdvlthrtrapsvrvaqttpfntrepvmlacyvwg
    fypadvtitwmkngqlvpshsnkektaqpngdwtyqtvsylaltpsygdvytcvvqhsgt
    sepirgdwtpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8iB (B:)
    gfvahvestcvlndagtpqdftycvsfnkdllacwdpdvgkivpcefgvlsrlaeiisni
    lneqeslihrlqnglqdcathtqpfwdvlthrtrapsvrvaqttpfntrepvmlacyvwg
    fypadvtitwmkngqlvpshsnkektaqpngdwtyqtvsylaltpsygdvytcvvqhsgt
    sepirgdwtp