PDB entry 1k89

View 1k89 on RCSB PDB site
Description:
Deposited on 1998-06-05, released 1999-01-27
The last revision prior to the SCOP 1.65 freeze date was dated 1999-01-27, with a file datestamp of 1999-01-27.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.143
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1k89_1, d1k89_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k89_ (-)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpylgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgarelgymygqy
    rkivggfyngvltgkarsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgn
    vawgaakklaelgakavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfg
    vqffpgekpwgqkvdiimpcatqndvdleqakkivannvkyyievanmpttnealrflmq
    qpnmvvapskavnaggvlvsgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaery
    glgynlvaganivgfqkiadammaqgiaw