PDB entry 1k7i

View 1k7i on RCSB PDB site
Description: PrtC from Erwinia chrysanthemi: Y228F mutant
Class: hydrolase
Keywords: metalloprotease, hydrolase, protease
Deposited on 2001-10-19, released 2002-10-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.197
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: secreted protease C
    Species: Erwinia chrysanthemi [TaxId:556]
    Gene: prtc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16317 (Start-478)
      • engineered (227)
    Domains in SCOPe 2.01: d1k7ia1, d1k7ia2
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k7iA (A:)
    mgknlslrqddaqhalsantssaynsvydflryhdrgdgltvngktsysidqaaaqitre
    nvswngtnvfgksanltfkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltf
    tevtgnksanitfgnytrdasgnldygtqayayypgnyqgagsswynynqsnirnpgsee
    ygrqtftheighalglahpgeynagegdpsyndavyaedsyqfsimsfwgenetgadyng
    hyggapmiddiaaiqrlyganmttrtgdsvygfnsntdrdfytatdsskalifsvwdagg
    tdtfdfsgysnnqrinlnegsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadni
    lqggagndvlyggagadtlyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafr
    negqlsfvqdqftgkgqevmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k7iA (A:)
    antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt
    fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt
    rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalgla
    hpgeynagegdpsyndavyaedsyqfsimsfwgenetgadynghyggapmiddiaaiqrl
    yganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinl
    negsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagad
    tlyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgq
    evmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv