PDB entry 1k7i

View 1k7i on RCSB PDB site
Description: prtc from erwinia chrysanthemi: y228f mutant
Deposited on 2001-10-19, released 2002-10-19
The last revision prior to the SCOP 1.63 freeze date was dated 2002-10-19, with a file datestamp of 2002-10-19.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.197
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k7iA (A:)
    antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt
    fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt
    rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalgla
    hpgeynagegdpsyndavyaedsyqfsimsfwgenetgadynghyggapmiddiaaiqrl
    yganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinl
    negsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagad
    tlyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgq
    evmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv