PDB entry 1k6v

View 1k6v on RCSB PDB site
Description: lack of synergy for inhibitors targeting a multi-drug resistant hiv-1 protease
Class: hydrolase
Keywords: indinavir, inhibitor recognition, drug resistance, hiv-1 protease, hydrolase
Deposited on 2001-10-17, released 2002-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35963 (0-98)
    • engineered (6)
    • engineered (13)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.08: d1k6va_
• Chain 'B':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35963 (0-98)
    • engineered (6)
    • engineered (13)
    • engineered (81)
    • engineered (83)
  Domains in SCOPe 2.08: d1k6vb_
• Heterogens: ACT, XN2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k6vA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptptnvigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k6vB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptptnvigrnlltqigctlnf