PDB entry 1k5b

View 1k5b on RCSB PDB site
Description: Crystal Structure of Human Angiogenin Variant des(121-123)
Class: hydrolase
Keywords: Hydrolase, ribonuclease, vascularization
Deposited on 2001-10-10, released 2002-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: angiogenin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03950 (0-119)
  Domains in SCOPe 2.08: d1k5ba_
• Heterogens: CIT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k5bA (A:)
  ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
  ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif