PDB entry 1k51

View 1k51 on RCSB PDB site
Description: a g55a mutation induces 3d domain swapping in the b1 domain of protein l from peptostreptococcus magnus
Deposited on 2001-10-09, released 2001-12-05
The last revision prior to the SCOP 1.65 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d1k51a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k51A (A:)
  mhhhhhhameevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdva
  dkaytlnikfag