PDB entry 1k4u

View 1k4u on RCSB PDB site
Description: solution structure of the c-terminal sh3 domain of p67phox complexed with the c-terminal tail region of p47phox
Deposited on 2001-10-08, released 2002-04-08
The last revision prior to the SCOP 1.71 freeze date was dated 2002-08-21, with a file datestamp of 2002-08-21.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'S':
    Domains in SCOP 1.71: d1k4us_

PDB Chain Sequences:

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k4uS (S:)
    qlkkgsqvealfsyeatqpedlefqegdiilvlskvneewlegeskgkvgifpkvfveds
    at