PDB entry 1k45

View 1k45 on RCSB PDB site
Description: the solution structure of the cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase.
Deposited on 2001-10-05, released 2002-05-29
The last revision prior to the SCOP 1.71 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1k45a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1k45A (A:)
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpwdieatafpvnvrpgvtytytiwaraeqdgavvsftvgnqsfqeygrlheqq
ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglaiasqp