PDB entry 1k3h

View 1k3h on RCSB PDB site
Description: nmr solution structure of oxidized cytochrome c-553 from bacillus pasteurii
Deposited on 2001-10-03, released 2001-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 2001-10-31, with a file datestamp of 2001-10-31.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1k3ha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k3hA (A:)
  vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
  eavaawlaekk