PDB entry 1k3g

View 1k3g on RCSB PDB site
Description: NMR Solution Structure of Oxidized Cytochrome c-553 from Bacillus pasteurii
Class: electron transport
Keywords: c-553, heme, cytochrome, bacillus pasteurii, electron transfer, electron transport
Deposited on 2001-10-03, released 2001-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c-553
  Species: Sporosarcina pasteurii [TaxId:1474]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82599 (0-70)
  Domains in SCOPe 2.07: d1k3ga_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k3gA (A:)
  vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
  eavaawlaekk