PDB entry 1k3c

View 1k3c on RCSB PDB site
Description: Phosphoenolpyruvate carboxykinase in complex with ADP, AlF3 and Pyruvate
Class: lyase
Keywords: Kinase, P-loop, gluconeogenesis, nucleotide-triphosphate hydrolase, LYASE
Deposited on 2001-10-02, released 2001-12-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Escherichia coli [TaxId:562]
    Gene: pckA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k3ca1, d1k3ca2
  • Heterogens: MG, ADP, AF3, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k3cA (A:)
    mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
    iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
    vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
    keqglnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgek
    gdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepei
    ynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifl
    tadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptq
    yaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnl
    aiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k3cA (A:)
    gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
    spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
    ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
    nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdvav
    ffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiynair
    rdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltadaf
    gvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptqyaevl
    vkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaipte
    lpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl