PDB entry 1k3a

View 1k3a on RCSB PDB site
Description: Structure of the Insulin-like Growth Factor 1 Receptor Kinase
Deposited on 2001-10-02, released 2001-11-28
The last revision prior to the SCOP 1.71 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1k3aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k3aA (A:)
    vpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerief
    lneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvlapp
    slskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyr
    kggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvme
    gglldkpdncpdmllelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k3aA (A:)
    vpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerief
    lneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpempslskmiqm
    ageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkggkgllp
    vrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpd
    ncpdmllelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk