PDB entry 1k38

View 1k38 on RCSB PDB site
Description: crystal structure of the class d beta-lactamase oxa-2
Class: hydrolase
Keywords: serine beta-lactamase, hydrolase, antibiotic resistance, carbamylated lysine
Deposited on 2001-10-02, released 2003-06-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.198
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase OXA-2
    Species: Salmonella typhimurium [TaxId:602]
    Gene: oxa-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A1V8
      • modified residue (53)
    Domains in SCOPe 2.05: d1k38a_
  • Chain 'B':
    Compound: Beta-lactamase OXA-2
    Species: Salmonella typhimurium [TaxId:602]
    Gene: oxa-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A1V8
      • modified residue (53)
    Domains in SCOPe 2.05: d1k38b_
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k38A (A:)
    qegtlersdwrkffsefqakgtivvaderqadramlvfdpvrskkryspastfkiphtlf
    aldagavrdefqifrwdgvnrgfaghnqdqdlrsamrnstvwvyelfakeigddkarryl
    kkidygnadpstsngdywiegslaisaqeqiaflrklyrnelpfrvehqrlvkdlmivea
    grnwilraktgwegrmgwwvgwvewptgsvffalnidtpnrmddlfkreaivrailrsie
    alppnpavnsdaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k38A (A:)
    tlersdwrkffsefqakgtivvaderqadramlvfdpvrskkryspastfkiphtlfald
    agavrdefqifrwdgvnrgfaghnqdqdlrsamrnstvwvyelfakeigddkarrylkki
    dygnadpstgdywiegslaisaqeqiaflrklyrnelpfrvehqrlvkdlmiveagrnwi
    lraktgwegrmgwwvgwvewptgsvffalnidtpnrmddlfkreaivrailrsiealpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k38B (B:)
    qegtlersdwrkffsefqakgtivvaderqadramlvfdpvrskkryspastfkiphtlf
    aldagavrdefqifrwdgvnrgfaghnqdqdlrsamrnstvwvyelfakeigddkarryl
    kkidygnadpstsngdywiegslaisaqeqiaflrklyrnelpfrvehqrlvkdlmivea
    grnwilraktgwegrmgwwvgwvewptgsvffalnidtpnrmddlfkreaivrailrsie
    alppnpavnsdaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k38B (B:)
    tlersdwrkffsefqakgtivvaderqadramlvfdpvrskkryspastfkiphtlfald
    agavrdefqifrwdgvnrghnqdqdlrsamrnstvwvyelfakeigddkarrylkkidyg
    nadpstdywiegslaisaqeqiaflrklyrnelpfrvehqrlvkdlmiveagrnwilrak
    tgwegrmgwwvgwvewptgsvffalnidtpnrmddlfkreaivrailrsiealpp