PDB entry 1k37

View 1k37 on RCSB PDB site
Description: nmr structure of human epiregulin
Deposited on 2001-10-02, released 2003-09-30
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1k37a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k37A (A:)
    vsitkcssdmngyclhgqciylvdmsqnycrcevgytgvrcehffl